PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00008.135
Common NameAMTR_s00008p00214750, LOC18423305
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family HD-ZIP
Protein Properties Length: 339aa    MW: 37250 Da    PI: 6.0545
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00008.135genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.33e-1953106356
                                               --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                                  Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                               k+++++ +q+++Le+ Fe ++++  e++++LA++lgL+ rqV vWFqNrRa++k
  evm_27.model.AmTr_v1.0_scaffold00008.135  53 KKRRLSVDQVKALEKNFEVENKLEPERKAKLAQELGLQPRQVAVWFQNRRARWK 106
                                               566899***********************************************9 PP

2HD-ZIP_I/II127.84.5e-4152143192
                               HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkra 69 
                                               ekkrrls +qvk+LE++Fe e+kLeperK++la+eLglqprqvavWFqnrRAR+ktkqlEkdy+ Lk++
  evm_27.model.AmTr_v1.0_scaffold00008.135  52 EKKRRLSVDQVKALEKNFEVENKLEPERKAKLAQELGLQPRQVAVWFQNRRARWKTKQLEKDYNLLKAN 120
                                               69******************************************************************* PP

                               HD-ZIP_I/II  70 ydalkeenerLekeveeLreelk 92 
                                               yd+lk + ++++k++e+L +el+
  evm_27.model.AmTr_v1.0_scaffold00008.135 121 YDNLKINFDNVKKDKETLMAELR 143
                                               ******************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.05E-1944110IPR009057Homeodomain-like
PROSITE profilePS5007117.8848108IPR001356Homeobox domain
SMARTSM003892.2E-1851112IPR001356Homeobox domain
PfamPF000461.9E-1653106IPR001356Homeobox domain
CDDcd000862.72E-1753109No hitNo description
Gene3DG3DSA:1.10.10.604.1E-2055115IPR009057Homeodomain-like
PRINTSPR000314.1E-67988IPR000047Helix-turn-helix motif
PROSITE patternPS00027083106IPR017970Homeobox, conserved site
PRINTSPR000314.1E-688104IPR000047Helix-turn-helix motif
PfamPF021833.6E-16108149IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MKRMESSDSL GALISMCPSA EEKNGGGGYS SRGFQSILDG FEEEEECGQA SEKKRRLSVD  60
QVKALEKNFE VENKLEPERK AKLAQELGLQ PRQVAVWFQN RRARWKTKQL EKDYNLLKAN  120
YDNLKINFDN VKKDKETLMA ELRGVKEKVG GRKSGGGGGS GGGDANKEAF PDPQDALAPI  180
PTSKDTEDLK GHTMDGQDRS TGICPDLKDG SDSDSSAILN DENSPLHHPQ SHHYHRPQTL  240
LSSVSSSSAI IAEAAPPTSP PPPLPFLSLH HHHSNNYHIF SSSSSSSSST NGGVTRFYPS  300
PFARMEEHNF LNADESSCNF FADEQAPSLP WYCSDHWN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1100108RRARWKTKQ
2149157GGRKSGGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00271DAPTransfer from AT2G22430Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006827970.10.0PREDICTED: homeobox-leucine zipper protein ATHB-6
TrEMBLW1NIU70.0W1NIU7_AMBTC; Uncharacterized protein
STRINGPOPTR_0005s07290.18e-87(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.11e-57homeobox protein 6
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]